Welcome to E-Tronics
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0

Bridges & Routers

Sub-Categories
Wireless Routers
2 product(s) found for "Bridges & Routers"
Wireless WiFi Repeater Wi-Fi Range Extender
Wireless WiFi Repeater Wi-Fi Range Extender
Overview:1. Improve wireless coverage in all WLAN networks.2. Access to the Internet for computers located on the edge or outside of the range of your access point.3. Complies with IEEE 802.11n, IEEE 802.11g, IEEE 802.11b standards.4. Provides up to 300Mbps transmission rates.5. Support 2.4 GHz WLAN...
Details Add To Cart
Wireless WiFi Repeater Wi-Fi Range Extender
Wireless WiFi Repeater Wi-Fi Range Extender
Overview:1. Improve wireless coverage in all WLAN networks.2. Access to the Internet for computers located on the edge or outside of the range of your access point.3. Complies with IEEE 802.11n, IEEE 802.11g, IEEE 802.11b standards.4. Provides up to 300Mbps transmission rates.5. Support 2.4 GHz WLAN...
Details Add To Cart
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i