Welcome to E-Tronics
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Dell Latitude 3380 business laptop, 13.3in HD Display, Intel Core i3-6006U, 4GB DDR4, 128GB Solid St
Dell Latitude 3380 business laptop, 13.3in HD Display, Intel Core i3-6006U, 4GB DDR4, 128GB Solid St
Dell Latitude 3380 business laptop, 13.3in HD Display, Intel Core i3-6006U, 4GB DDR4, 128GB Solid St
Dell Latitude 3380 business laptop, 13.3in HD Display, Intel Core i3-6006U, 4GB DDR4, 128GB Solid St
Dell Latitude 3380 business laptop, 13.3in HD Display, Intel Core i3-6006U, 4GB DDR4, 128GB Solid St
Dell Latitude 3380 business laptop, 13.3in HD Display, Intel Core i3-6006U, 4GB DDR4, 128GB Solid St

Dell Latitude 3380 business laptop, 13.3in HD Display, Intel Core i3-6006U, 4GB DDR4, 128GB Solid St

Product Code: B07KLYBVYJ
Product Condition: New
$177.59 inc. tax
 Add to Cart
Description
Everyday computing just got easier with the Dell Latitude 3380 Laptop. Fully loaded with a Core i3 2.00 GHz Processor; the Dell Latitude 3380 makes for a speedy and efficient Laptop. The 128 GB SSD provides ample space to store all crucial data safely.
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i