Welcome to E-Tronics
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Design Sense Geometric Ellipse Rose Pendant
Design Sense Geometric Ellipse Rose Pendant
Design Sense Geometric Ellipse Rose Pendant
Design Sense Geometric Ellipse Rose Pendant
Design Sense Geometric Ellipse Rose Pendant
Design Sense Geometric Ellipse Rose Pendant
Design Sense Geometric Ellipse Rose Pendant
Design Sense Geometric Ellipse Rose Pendant
Design Sense Geometric Ellipse Rose Pendant
Design Sense Geometric Ellipse Rose Pendant

Design Sense Geometric Ellipse Rose Pendant

Product Code: CJLX197426801AZ
Product Condition: New
weight: 5.0g
$0.00 inc. tax
 Add to Cart
Description

Product information:
Treatment Process: Electroplating
Color: Silver, 18K gold
Pendant material: Silver
Chain style: cross chain
Material: Silver
Purity: 925 silver
Popular elements: Rose


Packing list:
Necklace * 1
Product Image:
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i