Welcome to E-Tronics
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Dragon Ball Goku Skin Cover Sticker Decal for Nintendo Switch Lite Pokemon Console Joy-con Controlle
Dragon Ball Goku Skin Cover Sticker Decal for Nintendo Switch Lite Pokemon Console Joy-con Controlle
Dragon Ball Goku Skin Cover Sticker Decal for Nintendo Switch Lite Pokemon Console Joy-con Controlle
Dragon Ball Goku Skin Cover Sticker Decal for Nintendo Switch Lite Pokemon Console Joy-con Controlle
Dragon Ball Goku Skin Cover Sticker Decal for Nintendo Switch Lite Pokemon Console Joy-con Controlle
Dragon Ball Goku Skin Cover Sticker Decal for Nintendo Switch Lite Pokemon Console Joy-con Controlle
Dragon Ball Goku Skin Cover Sticker Decal for Nintendo Switch Lite Pokemon Console Joy-con Controlle
Dragon Ball Goku Skin Cover Sticker Decal for Nintendo Switch Lite Pokemon Console Joy-con Controlle
Dragon Ball Goku Skin Cover Sticker Decal for Nintendo Switch Lite Pokemon Console Joy-con Controlle
Dragon Ball Goku Skin Cover Sticker Decal for Nintendo Switch Lite Pokemon Console Joy-con Controlle
Dragon Ball Goku Skin Cover Sticker Decal for Nintendo Switch Lite Pokemon Console Joy-con Controlle
Dragon Ball Goku Skin Cover Sticker Decal for Nintendo Switch Lite Pokemon Console Joy-con Controlle
Dragon Ball Goku Skin Cover Sticker Decal for Nintendo Switch Lite Pokemon Console Joy-con Controlle
Dragon Ball Goku Skin Cover Sticker Decal for Nintendo Switch Lite Pokemon Console Joy-con Controlle
Dragon Ball Goku Skin Cover Sticker Decal for Nintendo Switch Lite Pokemon Console Joy-con Controlle
Dragon Ball Goku Skin Cover Sticker Decal for Nintendo Switch Lite Pokemon Console Joy-con Controlle
Dragon Ball Goku Skin Cover Sticker Decal for Nintendo Switch Lite Pokemon Console Joy-con Controlle
Dragon Ball Goku Skin Cover Sticker Decal for Nintendo Switch Lite Pokemon Console Joy-con Controlle
Dragon Ball Goku Skin Cover Sticker Decal for Nintendo Switch Lite Pokemon Console Joy-con Controlle
Dragon Ball Goku Skin Cover Sticker Decal for Nintendo Switch Lite Pokemon Console Joy-con Controlle
Dragon Ball Goku Skin Cover Sticker Decal for Nintendo Switch Lite Pokemon Console Joy-con Controlle
Dragon Ball Goku Skin Cover Sticker Decal for Nintendo Switch Lite Pokemon Console Joy-con Controlle
Dragon Ball Goku Skin Cover Sticker Decal for Nintendo Switch Lite Pokemon Console Joy-con Controlle
Dragon Ball Goku Skin Cover Sticker Decal for Nintendo Switch Lite Pokemon Console Joy-con Controlle
Dragon Ball Goku Skin Cover Sticker Decal for Nintendo Switch Lite Pokemon Console Joy-con Controlle
Dragon Ball Goku Skin Cover Sticker Decal for Nintendo Switch Lite Pokemon Console Joy-con Controlle
Dragon Ball Goku Skin Cover Sticker Decal for Nintendo Switch Lite Pokemon Console Joy-con Controlle
Dragon Ball Goku Skin Cover Sticker Decal for Nintendo Switch Lite Pokemon Console Joy-con Controlle
Dragon Ball Goku Skin Cover Sticker Decal for Nintendo Switch Lite Pokemon Console Joy-con Controlle
Dragon Ball Goku Skin Cover Sticker Decal for Nintendo Switch Lite Pokemon Console Joy-con Controlle
Dragon Ball Goku Skin Cover Sticker Decal for Nintendo Switch Lite Pokemon Console Joy-con Controlle
Dragon Ball Goku Skin Cover Sticker Decal for Nintendo Switch Lite Pokemon Console Joy-con Controlle

Dragon Ball Goku Skin Cover Sticker Decal for Nintendo Switch Lite Pokemon Console Joy-con Controlle

Product Code: 14:193#TN-NSLite-0075
Product Condition: New
$0.00 inc. tax
 Add to Cart
Description

SPECIFICATIONS

Item Type: Anime Accessories

Origin: Mainland China

Recommend Age: 14+y

Model Number: Stickers For Switch Lite

Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i