Welcome to E-Tronics
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Factory Wholesale 5-port 15A QC3.0 5USB Car Charger Fast Charge Car Charger One For Five Mobile Phon
Factory Wholesale 5-port 15A QC3.0 5USB Car Charger Fast Charge Car Charger One For Five Mobile Phon
Factory Wholesale 5-port 15A QC3.0 5USB Car Charger Fast Charge Car Charger One For Five Mobile Phon
Factory Wholesale 5-port 15A QC3.0 5USB Car Charger Fast Charge Car Charger One For Five Mobile Phon
Factory Wholesale 5-port 15A QC3.0 5USB Car Charger Fast Charge Car Charger One For Five Mobile Phon
Factory Wholesale 5-port 15A QC3.0 5USB Car Charger Fast Charge Car Charger One For Five Mobile Phon
Factory Wholesale 5-port 15A QC3.0 5USB Car Charger Fast Charge Car Charger One For Five Mobile Phon
Factory Wholesale 5-port 15A QC3.0 5USB Car Charger Fast Charge Car Charger One For Five Mobile Phon
Factory Wholesale 5-port 15A QC3.0 5USB Car Charger Fast Charge Car Charger One For Five Mobile Phon
Factory Wholesale 5-port 15A QC3.0 5USB Car Charger Fast Charge Car Charger One For Five Mobile Phon

Factory Wholesale 5-port 15A QC3.0 5USB Car Charger Fast Charge Car Charger One For Five Mobile Phon

Product Code: CJCD120193602BY
Product Condition: New
weight: 60.0g
$0.00 inc. tax
 Add to Cart
Description

Product information
Brand: Neutral
Custom processing: Yes
Input voltage: 12 (V)
Output voltage: 5 (V)
Output current: 7000 (mA)
Output interface: USB
Applicable charging range: general

Packing list
Charger x1



Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i