Welcome to E-Tronics
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Magnetic Three-in-one Data Cable Mobile Phone Charging Cable
Magnetic Three-in-one Data Cable Mobile Phone Charging Cable
Magnetic Three-in-one Data Cable Mobile Phone Charging Cable
Magnetic Three-in-one Data Cable Mobile Phone Charging Cable
Magnetic Three-in-one Data Cable Mobile Phone Charging Cable
Magnetic Three-in-one Data Cable Mobile Phone Charging Cable
Magnetic Three-in-one Data Cable Mobile Phone Charging Cable
Magnetic Three-in-one Data Cable Mobile Phone Charging Cable
Magnetic Three-in-one Data Cable Mobile Phone Charging Cable

Magnetic Three-in-one Data Cable Mobile Phone Charging Cable

Product Code: CJCD124745702BY
Product Condition: New
weight: 65.0g
$0.00 inc. tax
 Add to Cart
Description

Product Information:
 Interface: USB
Length: 0.4m
Number of branch connectors: one for three
Color: black, white, red
Features: Magnetic type

Package
CPlastic data cable *1



Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i