Welcome to E-Tronics
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Pencil 1nd Gen Storage Box Touch Tablet Pen Accessories Portable Hard Cover Travel Case
Pencil 1nd Gen Storage Box Touch Tablet Pen Accessories Portable Hard Cover Travel Case
Pencil 1nd Gen Storage Box Touch Tablet Pen Accessories Portable Hard Cover Travel Case
Pencil 1nd Gen Storage Box Touch Tablet Pen Accessories Portable Hard Cover Travel Case
Pencil 1nd Gen Storage Box Touch Tablet Pen Accessories Portable Hard Cover Travel Case
Pencil 1nd Gen Storage Box Touch Tablet Pen Accessories Portable Hard Cover Travel Case
Pencil 1nd Gen Storage Box Touch Tablet Pen Accessories Portable Hard Cover Travel Case
Pencil 1nd Gen Storage Box Touch Tablet Pen Accessories Portable Hard Cover Travel Case
Pencil 1nd Gen Storage Box Touch Tablet Pen Accessories Portable Hard Cover Travel Case
Pencil 1nd Gen Storage Box Touch Tablet Pen Accessories Portable Hard Cover Travel Case
Pencil 1nd Gen Storage Box Touch Tablet Pen Accessories Portable Hard Cover Travel Case

Pencil 1nd Gen Storage Box Touch Tablet Pen Accessories Portable Hard Cover Travel Case

Product Code: CJSJ114861601AZ
Product Condition: New
weight: 90.0g
$0.00 inc. tax
 Add to Cart
Description

Product information:
Type: pencil 1,2 generation storage box
Style: protective shell
Style: simple
Color: purple, green,, green, black, blue

Packing list:
Board 1st Generation 2nd Generation Pen Point Adapter Accessories Pen Case*1


Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i