Welcome to E-Tronics
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
SuperNES Nintend 21 Games SNES Game Console 16-bit SNES MINI Game Console U.S. Version 30 Games Supp
SuperNES Nintend 21 Games SNES Game Console 16-bit SNES MINI Game Console U.S. Version 30 Games Supp
SuperNES Nintend 21 Games SNES Game Console 16-bit SNES MINI Game Console U.S. Version 30 Games Supp
SuperNES Nintend 21 Games SNES Game Console 16-bit SNES MINI Game Console U.S. Version 30 Games Supp
SuperNES Nintend 21 Games SNES Game Console 16-bit SNES MINI Game Console U.S. Version 30 Games Supp
SuperNES Nintend 21 Games SNES Game Console 16-bit SNES MINI Game Console U.S. Version 30 Games Supp
SuperNES Nintend 21 Games SNES Game Console 16-bit SNES MINI Game Console U.S. Version 30 Games Supp
SuperNES Nintend 21 Games SNES Game Console 16-bit SNES MINI Game Console U.S. Version 30 Games Supp
SuperNES Nintend 21 Games SNES Game Console 16-bit SNES MINI Game Console U.S. Version 30 Games Supp

SuperNES Nintend 21 Games SNES Game Console 16-bit SNES MINI Game Console U.S. Version 30 Games Supp

Product Code: 14:29#NES 30
Product Condition: New
$0.00 inc. tax
 Add to Cart
Description

SPECIFICATIONS

Brand Name: CDIY

Supporting Language: French

Supporting Language: German

Supporting Language: ITALIAN

Supporting Language: Russian

Supporting Language: English

Supporting Language: Dutch

Supporting Language: Latin American Spanish

Supporting Language: Brazilian Portuguese

Category: Video Game Console

Origin: Mainland China

Bluetooth-compatible: no

Type of devices: OTHER

Wi-fi: no

Certification: CE

Package: Yes

Choice: yes

Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i