Welcome to E-Tronics
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Vintage High Profile Large Earrings Pearl Tassel Pendant
Vintage High Profile Large Earrings Pearl Tassel Pendant
Vintage High Profile Large Earrings Pearl Tassel Pendant
Vintage High Profile Large Earrings Pearl Tassel Pendant
Vintage High Profile Large Earrings Pearl Tassel Pendant
Vintage High Profile Large Earrings Pearl Tassel Pendant
Vintage High Profile Large Earrings Pearl Tassel Pendant
Vintage High Profile Large Earrings Pearl Tassel Pendant
Vintage High Profile Large Earrings Pearl Tassel Pendant
Vintage High Profile Large Earrings Pearl Tassel Pendant
Vintage High Profile Large Earrings Pearl Tassel Pendant

Vintage High Profile Large Earrings Pearl Tassel Pendant

Product Code: CJLY197403702BY
Product Condition: New
weight: 50.0g
$0.00 inc. tax
 Add to Cart
Description

Product information:
Material: Imitation Pearl
Modeling: U-shaped
Style: net red wind
Applicable population: Female



Packing list:
Earrings x1 pair



Product Image:


Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i