Welcome to E-Tronics
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Waterproof Sports Earphones Noise Cancelling Stereo Sound Headsets, Wired In-Ear Earbuds
Waterproof Sports Earphones Noise Cancelling Stereo Sound Headsets, Wired In-Ear Earbuds
Waterproof Sports Earphones Noise Cancelling Stereo Sound Headsets, Wired In-Ear Earbuds
Waterproof Sports Earphones Noise Cancelling Stereo Sound Headsets, Wired In-Ear Earbuds
Waterproof Sports Earphones Noise Cancelling Stereo Sound Headsets, Wired In-Ear Earbuds
Waterproof Sports Earphones Noise Cancelling Stereo Sound Headsets, Wired In-Ear Earbuds
Waterproof Sports Earphones Noise Cancelling Stereo Sound Headsets, Wired In-Ear Earbuds
Waterproof Sports Earphones Noise Cancelling Stereo Sound Headsets, Wired In-Ear Earbuds
Waterproof Sports Earphones Noise Cancelling Stereo Sound Headsets, Wired In-Ear Earbuds
Waterproof Sports Earphones Noise Cancelling Stereo Sound Headsets, Wired In-Ear Earbuds

Waterproof Sports Earphones Noise Cancelling Stereo Sound Headsets, Wired In-Ear Earbuds

Product Code: CJXFBXEJ02757-default
Product Condition: New
weight: 73.0g
$0.00 inc. tax
 Add to Cart
Description

Specification：
Model: BIBO-X7
Talk/Playing Time: up to 10 hours
Bluetooth Standard: V5.0
Operating Range: 33 feet/10 meters (No obstacles between)
Waterproof Rate: IPX5
Charging Time: 1.5 hours
Charging Voltage: DC 5V

Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i