Welcome to E-Tronics
USD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Xyxd Mobile Phone Live Broadcast Fill Light Neon Light Colorful Multicolored Lighting Selfie Stick V
Xyxd Mobile Phone Live Broadcast Fill Light Neon Light Colorful Multicolored Lighting Selfie Stick V
Xyxd Mobile Phone Live Broadcast Fill Light Neon Light Colorful Multicolored Lighting Selfie Stick V
Xyxd Mobile Phone Live Broadcast Fill Light Neon Light Colorful Multicolored Lighting Selfie Stick V
Xyxd Mobile Phone Live Broadcast Fill Light Neon Light Colorful Multicolored Lighting Selfie Stick V
Xyxd Mobile Phone Live Broadcast Fill Light Neon Light Colorful Multicolored Lighting Selfie Stick V
Xyxd Mobile Phone Live Broadcast Fill Light Neon Light Colorful Multicolored Lighting Selfie Stick V
Xyxd Mobile Phone Live Broadcast Fill Light Neon Light Colorful Multicolored Lighting Selfie Stick V
Xyxd Mobile Phone Live Broadcast Fill Light Neon Light Colorful Multicolored Lighting Selfie Stick V

Xyxd Mobile Phone Live Broadcast Fill Light Neon Light Colorful Multicolored Lighting Selfie Stick V

Product Code: CJVR106252402BY
Product Condition: New
weight: 370.0g
$0.00 inc. tax
 Add to Cart
Description

Product information:

Brand: XYXD
Item No.: MJ07PRO Douyin Version
Model: MJ07PRO vibrato version
Type: Handle flash
Applicable models: mobile phone universal
Flash type: ordinary flash
Whether it can be rotated: Yes
Product size: 215*160*70mm
Product weight: 0.35 (KG)

Size information:


Packing list :

Selfie stick *1



Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i